PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G55160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 354aa    MW: 39538.3 Da    PI: 8.9169
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G55160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.16.4e-202068250
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  r e++  rqv fskRr+g +KKA ELS+LC+a+va  +fs+ gk y +s
  OB01G55160.1 20 RMESEEARQVCFSKRRAGFFKKARELSILCGADVAAAVFSPAGKAYSFS 68
                  679999****************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-301170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.9181171IPR002100Transcription factor, MADS-box
CDDcd002651.16E-361284No hitNo description
SuperFamilySSF554557.33E-261286IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-181333IPR002100Transcription factor, MADS-box
PfamPF003195.4E-232067IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-183348IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-184869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVAPVRRRPS LGRQKIEIRR MESEEARQVC FSKRRAGFFK KARELSILCG ADVAAAVFSP  60
AGKAYSFSHP SVECLLERFL DSSSPPTQQQ GNAPDLLTAC INPDSTKTPS VSGIFGEGSG  120
QGLKAKKMKH SDEQEVAEMN VIPKRKKIKH PEVLKETITS TVALDEKEKN RFRVIVGPMD  180
MSTLDNDTGS KAFKDAVMTQ MVVPSIPQEC TLVYLPVKKG SDWSVYCINK VCQRIDYLIY  240
SSNEEPMDAA SLCEPFLEEV PFEQEISSND TSLLAMNFME KYNGKLFNLG DKDTKTWSEN  300
YRKSVLARLF DQRANAPGGV AKKQPGSQLT APFNPTFIHA QDHKTVPKFR NRCP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036272e-75AP003627.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0459B04.
GenBankAP0149572e-75AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126092e-75CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3L8G00.0J3L8G0_ORYBR; Uncharacterized protein
STRINGOB01G55160.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-24AGAMOUS-like 62